Lineage for d3d29g_ (3d29 G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)
  8. 1045708Domain d3d29g_: 3d29 G: [157226]
    Other proteins in same PDB: d3d291_, d3d292_, d3d29a_, d3d29b_, d3d29c_, d3d29e_, d3d29f_, d3d29h_, d3d29i_, d3d29j_, d3d29k_, d3d29l_, d3d29m_, d3d29n_, d3d29o_, d3d29p_, d3d29q_, d3d29s_, d3d29t_, d3d29v_, d3d29w_, d3d29x_, d3d29y_, d3d29z_
    automated match to d1g65g_
    complexed with feb

Details for d3d29g_

PDB Entry: 3d29 (more details), 2.6 Å

PDB Description: proteasome inhibition by fellutamide b
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3d29g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d29g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3d29g_:

Click to download the PDB-style file with coordinates for d3d29g_.
(The format of our PDB-style files is described here.)

Timeline for d3d29g_: