Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries) |
Domain d3cwbp1: 3cwb P:262-380 [157047] Other proteins in same PDB: d3cwbc2, d3cwbp2 automatically matched to d1bccc2 complexed with azi, bog, cdl, fes, hec, hem, icx, pee, unl, uq |
PDB Entry: 3cwb (more details), 3.51 Å
SCOPe Domain Sequences for d3cwbp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cwbp1 f.32.1.1 (P:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3cwbp1: