Lineage for d3cwbc1 (3cwb C:262-380)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3027983Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 3027991Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 3028001Domain d3cwbc1: 3cwb C:262-380 [157045]
    Other proteins in same PDB: d3cwbc2, d3cwbp2
    automatically matched to d1bccc2
    complexed with azi, bog, cdl, fes, hec, hem, icx, pee, unl, uq

Details for d3cwbc1

PDB Entry: 3cwb (more details), 3.51 Å

PDB Description: chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3cwbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwbc1 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3cwbc1:

Click to download the PDB-style file with coordinates for d3cwbc1.
(The format of our PDB-style files is described here.)

Timeline for d3cwbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwbc2