SCOPe 2.08: Domain d3cvtd1: 3cvt D:100-282

Lineage for d3cvtd1 (3cvt D:100-282)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
   Uniprot P04395

8. Domain d3cvtd1: 3cvt D:100-282 [157025]
   Other proteins in same PDB: d3cvta2, d3cvtb2, d3cvtc2, d3cvtd2
   automated match to d1mpga1
   protein/DNA complex

Details for d3cvtd1

PDB Entry: 3cvt, 2.5 Å

PDB Description: crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair

PDB Compounds: (D:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3cvtd1:

Sequence; same for both SEQRES and ATOM records:

>d3cvtd1 a.96.1.3 (D:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

Timeline for d3cvtd1:

• d3cvtd1 first appeared in SCOP 1.75
  
• d3cvtd1 appears in SCOPe 2.07