| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
| Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
| Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) |
| Species Escherichia coli [TaxId:562] [48159] (11 PDB entries) Uniprot P04395 |
| Domain d3cvtb1: 3cvt B:100-282 [157021] Other proteins in same PDB: d3cvta2, d3cvtb2, d3cvtc2, d3cvtd2 automated match to d1mpga1 protein/DNA complex |
PDB Entry: 3cvt (more details), 2.5 Å
SCOPe Domain Sequences for d3cvtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cvtb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea
Timeline for d3cvtb1: