SCOPe 2.04: Domain d3ct6a1: 3ct6 A:1-123

Lineage for d3ct6a1 (3ct6 A:1-123)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.2: DhaM-like [159618] (2 proteins)
   probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549)
   automatically mapped to Pfam PF03610

6. Protein PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM [159621] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [159622] (2 PDB entries)
   Uniprot Q9CIV6 1-123

8. Domain d3ct6a1: 3ct6 A:1-123 [156977]

Details for d3ct6a1

PDB Entry: 3ct6, 1.1 Å

PDB Description: crystal structure of dham of l. lactis

PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit dhaM

SCOPe Domain Sequences for d3ct6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ct6a1 c.54.1.2 (A:1-123) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM {Lactococcus lactis [TaxId: 1358]}
mtygivivshspeiasglkklirevaknisltaigglengeigtsfdrvmnaieeneadn
lltffdlgsarmnldlvsemtdkeltifnvpliegaytasalleagatfeaikeqlekml
iek

Timeline for d3ct6a1:

• d3ct6a1 first appeared in SCOP 1.75
  
• d3ct6a1 appears in SCOPe 2.03
  
• d3ct6a1 appears in SCOPe 2.05
  
• d3ct6a1 appears in the current release, SCOPe 2.08