Lineage for d3ct6a1 (3ct6 A:1-123)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883312Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883313Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2883329Family c.54.1.2: DhaM-like [159618] (2 proteins)
    probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549)
    automatically mapped to Pfam PF03610
  6. 2883330Protein PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM [159621] (1 species)
  7. 2883331Species Lactococcus lactis [TaxId:1358] [159622] (2 PDB entries)
    Uniprot Q9CIV6 1-123
  8. 2883332Domain d3ct6a1: 3ct6 A:1-123 [156977]
    Other proteins in same PDB: d3ct6a2, d3ct6b3

Details for d3ct6a1

PDB Entry: 3ct6 (more details), 1.1 Å

PDB Description: crystal structure of dham of l. lactis
PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit dhaM

SCOPe Domain Sequences for d3ct6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ct6a1 c.54.1.2 (A:1-123) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM {Lactococcus lactis [TaxId: 1358]}
mtygivivshspeiasglkklirevaknisltaigglengeigtsfdrvmnaieeneadn
lltffdlgsarmnldlvsemtdkeltifnvpliegaytasalleagatfeaikeqlekml
iek

SCOPe Domain Coordinates for d3ct6a1:

Click to download the PDB-style file with coordinates for d3ct6a1.
(The format of our PDB-style files is described here.)

Timeline for d3ct6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ct6a2