| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.2: DhaM-like [159618] (2 proteins) probable link between the PTS system fructose IIA component-like superfamily and the DAK1/DegV-like superfamily (82549) automatically mapped to Pfam PF03610 |
| Protein PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM [159621] (1 species) |
| Species Lactococcus lactis [TaxId:1358] [159622] (2 PDB entries) Uniprot Q9CIV6 1-123 |
| Domain d3ct6b2: 3ct6 B:1-123 [156978] Other proteins in same PDB: d3ct6a2, d3ct6b3 automated match to d3ct6a1 |
PDB Entry: 3ct6 (more details), 1.1 Å
SCOPe Domain Sequences for d3ct6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ct6b2 c.54.1.2 (B:1-123) PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM {Lactococcus lactis [TaxId: 1358]}
mtygivivshspeiasglkklirevaknisltaigglengeigtsfdrvmnaieeneadn
lltffdlgsarmnldlvsemtdkeltifnvpliegaytasalleagatfeaikeqlekml
iek
Timeline for d3ct6b2: