Lineage for d3csib1 (3csi B:79-209)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735942Protein Class pi GST [81347] (4 species)
  7. 1735943Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1735959Domain d3csib1: 3csi B:79-209 [156967]
    Other proteins in same PDB: d3csia2, d3csib2, d3csic2, d3csid2
    automated match to d1gssa1
    complexed with ca, cl, co3, gsh, lz6, mes, so4

Details for d3csib1

PDB Entry: 3csi (more details), 1.9 Å

PDB Description: crystal structure of the glutathione transferase pi allelic variant*c, i104v/a113v, in complex with the chlorambucil-glutathione conjugate
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3csib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3csib1 a.45.1.1 (B:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyvsliytnyevgkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d3csib1:

Click to download the PDB-style file with coordinates for d3csib1.
(The format of our PDB-style files is described here.)

Timeline for d3csib1: