Lineage for d1hdja_ (1hdj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979943Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1979944Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 1979968Protein HSP40 [46569] (1 species)
  7. 1979969Species Human (Homo sapiens) [TaxId:9606] [46570] (1 PDB entry)
  8. 1979970Domain d1hdja_: 1hdj A: [15696]

Details for d1hdja_

PDB Entry: 1hdj (more details)

PDB Description: human hsp40 (hdj-1), nmr
PDB Compounds: (A:) human hsp40

SCOPe Domain Sequences for d1hdja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]}
mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
reifdrygeeglkgsgc

SCOPe Domain Coordinates for d1hdja_:

Click to download the PDB-style file with coordinates for d1hdja_.
(The format of our PDB-style files is described here.)

Timeline for d1hdja_: