Lineage for d1hdja1 (1hdj A:0-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689869Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 2689893Protein HSP40 [46569] (1 species)
  7. 2689894Species Human (Homo sapiens) [TaxId:9606] [46570] (1 PDB entry)
  8. 2689895Domain d1hdja1: 1hdj A:0-75 [15696]
    Other proteins in same PDB: d1hdja2

Details for d1hdja1

PDB Entry: 1hdj (more details)

PDB Description: human hsp40 (hdj-1), nmr
PDB Compounds: (A:) human hsp40

SCOPe Domain Sequences for d1hdja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdja1 a.2.3.1 (A:0-75) HSP40 {Human (Homo sapiens) [TaxId: 9606]}
mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
reifdrygeeglkgsg

SCOPe Domain Coordinates for d1hdja1:

Click to download the PDB-style file with coordinates for d1hdja1.
(The format of our PDB-style files is described here.)

Timeline for d1hdja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdja2