SCOP 1.61: Domain d1fpob1: 1fpo B:1-76

Lineage for d1fpob1 (1fpo B:1-76)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.3: Chaperone J-domain [46565] (1 family)

5. Family a.2.3.1: Chaperone J-domain [46566] (4 proteins)

6. Protein HSC20 (HSCB), N-terminal (J) domain [46567] (1 species)

7. Species Escherichia coli [TaxId:562] [46568] (1 PDB entry)

8. Domain d1fpob1: 1fpo B:1-76 [15694]
   Other proteins in same PDB: d1fpoa2, d1fpob2, d1fpoc2

Details for d1fpob1

PDB Entry: 1fpo, 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli

SCOP Domain Sequences for d1fpob1:

Sequence; same for both SEQRES and ATOM records:

>d1fpob1 a.2.3.1 (B:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli}
mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
lrhplmraeyllslhg

Timeline for d1fpob1:

• d1fpob1 first appeared (with stable ids) in SCOP 1.55
  
• d1fpob1 appears in SCOP 1.59
  
• d1fpob1 appears in SCOP 1.63
  
• d1fpob1 appears in the current release, SCOPe 2.08