Lineage for d1fpob1 (1fpo B:1-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689869Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 2689888Protein HSC20 (HSCB), N-terminal (J) domain [46567] (1 species)
  7. 2689889Species Escherichia coli [TaxId:562] [46568] (1 PDB entry)
  8. 2689891Domain d1fpob1: 1fpo B:1-76 [15694]
    Other proteins in same PDB: d1fpoa2, d1fpob2, d1fpoc2

Details for d1fpob1

PDB Entry: 1fpo (more details), 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli
PDB Compounds: (B:) chaperone protein hscb

SCOPe Domain Sequences for d1fpob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpob1 a.2.3.1 (B:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}
mdyftlfglparyqldtqalslrfqdlqrqyhpdkfasgsqaeqlaavqqsatinqawqt
lrhplmraeyllslhg

SCOPe Domain Coordinates for d1fpob1:

Click to download the PDB-style file with coordinates for d1fpob1.
(The format of our PDB-style files is described here.)

Timeline for d1fpob1: