Lineage for d3cqzh1 (3cqz H:2-146)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800248Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
  6. 800249Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 800250Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries)
    Uniprot P20436
  8. 800254Domain d3cqzh1: 3cqz H:2-146 [156932]
    Other proteins in same PDB: d3cqza1, d3cqzb1, d3cqzf1, d3cqzj1, d3cqzk1, d3cqzl1
    automatically matched to d1a1da_
    complexed with ilx, trx, zn

Details for d3cqzh1

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOP Domain Sequences for d3cqzh1:

Sequence, based on SEQRES records: (download)

>d3cqzh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d3cqzh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
trswrppqagdrsladdydyvmygtaykfeevskvyysfggllmrleenayllirr

SCOP Domain Coordinates for d3cqzh1:

Click to download the PDB-style file with coordinates for d3cqzh1.
(The format of our PDB-style files is described here.)

Timeline for d3cqzh1: