Lineage for d3cqzh_ (3cqz H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950989Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
  6. 950990Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 950991Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries)
    Uniprot P20436
  8. 950993Domain d3cqzh_: 3cqz H: [156932]
    Other proteins in same PDB: d3cqza1, d3cqzb_, d3cqzf1, d3cqzj_, d3cqzk_, d3cqzl1
    automated match to d1a1da_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3cqzh_

PDB Entry: 3cqz (more details), 2.8 Å

PDB Description: Crystal structure of 10 subunit RNA polymerase II in complex with the inhibitor alpha-amanitin
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d3cqzh_:

Sequence, based on SEQRES records: (download)

>d3cqzh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d3cqzh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
trswrppqagdrsladdydyvmygtaykfeevskvyysfggllmrleenayllirr

SCOPe Domain Coordinates for d3cqzh_:

Click to download the PDB-style file with coordinates for d3cqzh_.
(The format of our PDB-style files is described here.)

Timeline for d3cqzh_: