Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) contains two Fe4-S4 clusters |
Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries) |
Domain d1h7wb1: 1h7w B:2-183 [15684] Other proteins in same PDB: d1h7wa2, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd2, d1h7wd3, d1h7wd4, d1h7wd5 complexed with fad, fmn, sf4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOPe Domain Sequences for d1h7wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek mp
Timeline for d1h7wb1:
View in 3D Domains from same chain: (mouse over for more information) d1h7wb2, d1h7wb3, d1h7wb4, d1h7wb5 |