Lineage for d1h7wb1 (1h7w B:2-183)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 789Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 800Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 801Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
  7. 802Species Wild boar (Sus scrofa) [46555] (2 PDB entries)
  8. 804Domain d1h7wb1: 1h7w B:2-183 [15684]
    Other proteins in same PDB: d1h7wa2, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd2, d1h7wd3, d1h7wd4, d1h7wd5

Details for d1h7wb1

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig

SCOP Domain Sequences for d1h7wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Wild boar (Sus scrofa)}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOP Domain Coordinates for d1h7wb1:

Click to download the PDB-style file with coordinates for d1h7wb1.
(The format of our PDB-style files is described here.)

Timeline for d1h7wb1: