Lineage for d3clrd1 (3clr D:1-191)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842395Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1842396Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding domain of DHS-like fold
  7. 1842400Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)
  8. 1842404Domain d3clrd1: 3clr D:1-191 [156755]
    Other proteins in same PDB: d3clrc_, d3clrd2
    automated match to d1o96b1
    complexed with amp, fad, po4; mutant

Details for d3clrd1

PDB Entry: 3clr (more details), 1.9 Å

PDB Description: crystal structure of the r236a etf mutant from m. methylotrophus
PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOPe Domain Sequences for d3clrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clrd1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvev

SCOPe Domain Coordinates for d3clrd1:

Click to download the PDB-style file with coordinates for d3clrd1.
(The format of our PDB-style files is described here.)

Timeline for d3clrd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3clrd2
View in 3D
Domains from other chains:
(mouse over for more information)
d3clrc_