SCOPe 2.08: Domain d3clrd1: 3clr D:1-191

Lineage for d3clrd1 (3clr D:1-191)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding domain of DHS-like fold

7. Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)

8. Domain d3clrd1: 3clr D:1-191 [156755]
   Other proteins in same PDB: d3clrc_, d3clrd2
   automated match to d1o96b1
   complexed with amp, fad, po4; mutant

Details for d3clrd1

PDB Entry: 3clr, 1.9 Å

PDB Description: crystal structure of the r236a etf mutant from m. methylotrophus

PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOPe Domain Sequences for d3clrd1:

Sequence; same for both SEQRES and ATOM records:

>d3clrd1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvev

Timeline for d3clrd1:

• d3clrd1 first appeared in SCOP 1.75
  
• d3clrd1 appears in SCOPe 2.07