SCOPe 2.05: Domain d3clrd2: 3clr D:192-319

Lineage for d3clrd2 (3clr D:192-319)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
   lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain

6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)

7. Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries)

8. Domain d3clrd2: 3clr D:192-319 [156756]
   Other proteins in same PDB: d3clrc_, d3clrd1
   automated match to d1o97d2
   complexed with amp, fad, po4; mutant

Details for d3clrd2

PDB Entry: 3clr, 1.9 Å

PDB Description: crystal structure of the r236a etf mutant from m. methylotrophus

PDB Compounds: (D:) Electron transfer flavoprotein subunit alpha

SCOPe Domain Sequences for d3clrd2:

Sequence; same for both SEQRES and ATOM records:

>d3clrd2 c.31.1.2 (D:192-319) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
gggndidittvdfimsigrgigeetnveqfreladeagatlccsapiadagwlpksrqvg
qsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdie
eelkaqla

Timeline for d3clrd2:

• d3clrd2 first appeared in SCOP 1.75
  
• d3clrd2 appears in SCOPe 2.04
  
• d3clrd2 appears in SCOPe 2.06
  
• d3clrd2 appears in the current release, SCOPe 2.08