SCOPe 2.01: Domain d3chsa3: 3chs A:209-460

Lineage for d3chsa3 (3chs A:209-460)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
   adopts thermolysin-like fold

6. Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64340] (15 PDB entries)
   Uniprot P09960

8. Domain d3chsa3: 3chs A:209-460 [156655]
   Other proteins in same PDB: d3chsa1, d3chsa2
   automatically matched to d1gw6a3
   complexed with 4bu, imd, yb, zn

Details for d3chsa3

PDB Entry: 3chs, 2.55 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with (2s)-2- amino-5-[[4-[(2s)-2-hydroxy-2-phenyl-ethoxy]phenyl]amino]-5-oxo- pentanoic acid

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3chsa3:

Sequence; same for both SEQRES and ATOM records:

>d3chsa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d3chsa3:

• d3chsa3 first appeared in SCOP 1.75
  
• d3chsa3 appears in SCOPe 2.02
  
• d3chsa3 appears in the current release, SCOPe 2.08