SCOPe 2.01: Domain d3chpa1: 3chp A:461-610

Lineage for d3chpa1 (3chp A:461-610)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
   this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain

6. Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63610] (15 PDB entries)
   Uniprot P09960

8. Domain d3chpa1: 3chp A:461-610 [156644]
   Other proteins in same PDB: d3chpa2, d3chpa3
   automatically matched to d1gw6a1
   complexed with 4bo, act, imd, yb, zn

Details for d3chpa1

PDB Entry: 3chp, 2.1 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with (3s)-3- amino-4-oxo-4-[(4-phenylmethoxyphenyl)amino]butanoic acid

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3chpa1:

Sequence; same for both SEQRES and ATOM records:

>d3chpa1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

Timeline for d3chpa1:

• d3chpa1 first appeared in SCOP 1.75
  
• d3chpa1 appears in SCOPe 2.02
  
• d3chpa1 appears in the current release, SCOPe 2.08