Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Chitinase 1 [51548] (2 species) |
Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries) Uniprot Q873X9 |
Domain d3chda1: 3chd A:39-298,A:361-433 [156629] Other proteins in same PDB: d3chda2, d3chdb2 automatically matched to d1w9pa1 complexed with so4, wrg |
PDB Entry: 3chd (more details), 2 Å
SCOPe Domain Sequences for d3chda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3chda1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt vvnalggtgvfeqsqneldypvsqydnlrngmqt
Timeline for d3chda1: