Lineage for d3chda1 (3chd A:39-298,A:361-433)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340706Protein Chitinase 1 [51548] (2 species)
  7. 1340707Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries)
    Uniprot Q873X9
  8. 1340718Domain d3chda1: 3chd A:39-298,A:361-433 [156629]
    Other proteins in same PDB: d3chda2, d3chdb2
    automated match to d1w9pa1
    complexed with so4, wrg

Details for d3chda1

PDB Entry: 3chd (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with dipeptide
PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d3chda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chda1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllkevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmqt

SCOPe Domain Coordinates for d3chda1:

Click to download the PDB-style file with coordinates for d3chda1.
(The format of our PDB-style files is described here.)

Timeline for d3chda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3chda2