Lineage for d1cpcl_ (1cpc L:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077126Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1077127Species Fremyella diplosiphon [TaxId:1197] [88943] (1 PDB entry)
  8. 1077129Domain d1cpcl_: 1cpc L: [15646]
    Other proteins in same PDB: d1cpca_, d1cpck_
    complexed with ch2, cyc

Details for d1cpcl_

PDB Entry: 1cpc (more details), 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution
PDB Compounds: (L:) c-phycocyanin (beta subunit)

SCOPe Domain Sequences for d1cpcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpcl_ a.1.1.3 (L:) Phycocyanin beta subunit {Fremyella diplosiphon [TaxId: 1197]}
mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal
gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava

SCOPe Domain Coordinates for d1cpcl_:

Click to download the PDB-style file with coordinates for d1cpcl_.
(The format of our PDB-style files is described here.)

Timeline for d1cpcl_: