Lineage for d1ewaa_ (1ewa A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075024Protein Dehaloperoxidase [46530] (1 species)
  7. 1075025Species Amphitrite ornata [TaxId:129555] [46531] (20 PDB entries)
  8. 1075058Domain d1ewaa_: 1ewa A: [15639]
    complexed with hem, iol, so4

Details for d1ewaa_

PDB Entry: 1ewa (more details), 2.5 Å

PDB Description: Dehaloperoxidase and 4-iodophenol
PDB Compounds: (A:) dehaloperoxidase

SCOPe Domain Sequences for d1ewaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewaa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d1ewaa_:

Click to download the PDB-style file with coordinates for d1ewaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ewaa_: