Lineage for d3cce21 (3cce 2:1-49)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099678Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 1099679Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1099680Protein Ribosomal protein L39e [48664] (1 species)
  7. 1099681Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1099700Domain d3cce21: 3cce 2:1-49 [156261]
    Other proteins in same PDB: d3cce11, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cce21

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cce21:

Sequence, based on SEQRES records: (download)

>d3cce21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3cce21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d3cce21:

Click to download the PDB-style file with coordinates for d3cce21.
(The format of our PDB-style files is described here.)

Timeline for d3cce21: