Lineage for d3calc1 (3cal C:63-108)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064849Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1064850Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1064851Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1064852Protein Fibronectin [57605] (1 species)
  7. 1064853Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1064860Domain d3calc1: 3cal C:63-108 [156153]
    automatically matched to d1o9aa2
    complexed with ace, nh2

Details for d3calc1

PDB Entry: 3cal (more details), 1.7 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
PDB Compounds: (C:) Fibronectin

SCOPe Domain Sequences for d3calc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3calc1 g.27.1.1 (C:63-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

SCOPe Domain Coordinates for d3calc1:

Click to download the PDB-style file with coordinates for d3calc1.
(The format of our PDB-style files is described here.)

Timeline for d3calc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3calc2