PDB entry 3cal

View 3cal on RCSB PDB site
Description: Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
Class: cell adhesion
Keywords: Fibronectin, 2F13F1, Beta zipper, Staphylococcus Aureus, Acute phase, Alternative splicing, Cell adhesion, Extracellular matrix, Glycoprotein, Heparin-binding, Phosphoprotein, Polymorphism, Pyrrolidone carboxylic acid, Secreted, Sulfation, Cell wall, Peptidoglycan-anchor, Virulence
Deposited on 2008-02-20, released 2008-08-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1, FN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (Start-89)
  Domains in SCOPe 2.01: d3cala1, d3cala2
• Chain 'B':
  Compound: Fibronectin-binding protein A
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (0-17)
• Chain 'C':
  Compound: Fibronectin
  Species: Homo sapiens [TaxId:9606]
  Gene: FN1, FN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02751 (Start-89)
  Domains in SCOPe 2.01: d3calc1, d3calc2
• Chain 'D':
  Compound: Fibronectin-binding protein A
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14738 (0-17)
• Heterogens: ACE, NH2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3calA (A:)
  aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
  twrrphetggymlecvclgngkgewtckpi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3calA (A:)
  eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigdt
  wrrpheggymlecvclgngkgewtckpi
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3calC (C:)
  aeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigd
  twrrphetggymlecvclgngkgewtckpi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3calC (C:)
  eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianrcheggqsykigdt
  wrrphegymlecvclgngkgewtckpi
  

  
  
• Chain 'D':
  No sequence available.