SCOPe 2.08: Domain d3cala1: 3cal A:63-108

Lineage for d3cala1 (3cal A:63-108)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d3cala1: 3cal A:63-108 [156151]
   automatically matched to d1o9aa2

Details for d3cala1

PDB Entry: 3cal, 1.7 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-5

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d3cala1:

Sequence; same for both SEQRES and ATOM records:

>d3cala1 g.27.1.1 (A:63-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

Timeline for d3cala1:

• d3cala1 first appeared in SCOP 1.75
  
• d3cala1 appears in SCOPe 2.07