Lineage for d1o9aa2 (1o9a A:61-109)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034865Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 3034866Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 3034867Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 3034868Protein Fibronectin [57605] (1 species)
  7. 3034869Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)
  8. 3034910Domain d1o9aa2: 1o9a A:61-109 [86687]
    1st and 2nd modules in complex with a peptide from the streptococcal fibronectin binding protein, FnbB, chain B

Details for d1o9aa2

PDB Entry: 1o9a (more details)

PDB Description: solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1o9aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9aa2 g.27.1.1 (A:61-109) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eaeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianr

SCOPe Domain Coordinates for d1o9aa2:

Click to download the PDB-style file with coordinates for d1o9aa2.
(The format of our PDB-style files is described here.)

Timeline for d1o9aa2:

3034910
d1o9aa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1o9aa1