Lineage for d3c9ta2 (3c9t A:138-300)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041476Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1041477Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 1041478Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1041522Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 1041523Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
    Uniprot O67883
  8. 1041530Domain d3c9ta2: 3c9t A:138-300 [156141]
    Other proteins in same PDB: d3c9ta1, d3c9tb1
    automatically matched to d1vqva2
    complexed with acp, mg, tps

Details for d3c9ta2

PDB Entry: 3c9t (more details), 2.6 Å

PDB Description: aathil complexed with amppcp and tmp
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9ta2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

SCOPe Domain Coordinates for d3c9ta2:

Click to download the PDB-style file with coordinates for d3c9ta2.
(The format of our PDB-style files is described here.)

Timeline for d3c9ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c9ta1