Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries) Uniprot O67883 |
Domain d3c9ta2: 3c9t A:138-300 [156141] Other proteins in same PDB: d3c9ta1, d3c9tb1 automatically matched to d1vqva2 complexed with acp, mg, tps |
PDB Entry: 3c9t (more details), 2.6 Å
SCOP Domain Sequences for d3c9ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9ta2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]} rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
Timeline for d3c9ta2: