| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
| Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries) Uniprot O67883 |
| Domain d3c9sb2: 3c9s B:138-297 [156139] Other proteins in same PDB: d3c9sa1, d3c9sb1 automated match to d3c9ub2 complexed with acp, mg |
PDB Entry: 3c9s (more details), 2.2 Å
SCOPe Domain Sequences for d3c9sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9sb2 d.139.1.1 (B:138-297) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkk
Timeline for d3c9sb2: