Lineage for d3c9sb2 (3c9s B:138-297)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978205Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 2978206Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries)
    Uniprot O67883
  8. 2978210Domain d3c9sb2: 3c9s B:138-297 [156139]
    Other proteins in same PDB: d3c9sa1, d3c9sa3, d3c9sb1, d3c9sb3
    automated match to d3c9ub2
    complexed with acp, mg

Details for d3c9sb2

PDB Entry: 3c9s (more details), 2.2 Å

PDB Description: aathil complexed with amppcp
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9sb2 d.139.1.1 (B:138-297) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkk

SCOPe Domain Coordinates for d3c9sb2:

Click to download the PDB-style file with coordinates for d3c9sb2.
(The format of our PDB-style files is described here.)

Timeline for d3c9sb2: