Lineage for d3lhbi_ (3lhb I:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717312Protein Lamprey globin [46518] (2 species)
  7. 1717326Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 1717336Domain d3lhbi_: 3lhb I: [15612]
    complexed with hem

Details for d3lhbi_

PDB Entry: 3lhb (more details), 2.7 Å

PDB Description: the 2.7 angstrom crystal structure of deoxygenated hemoglobin from the sea lamprey (petromyzon marinus)
PDB Compounds: (I:) protein (hemoglobin)

SCOPe Domain Sequences for d3lhbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhbi_ a.1.1.2 (I:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d3lhbi_:

Click to download the PDB-style file with coordinates for d3lhbi_.
(The format of our PDB-style files is described here.)

Timeline for d3lhbi_: