Lineage for d3c92k1 (3c92 K:1-203)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993227Species Thermoplasma acidophilum [TaxId:2303] [56253] (7 PDB entries)
  8. 2993303Domain d3c92k1: 3c92 K:1-203 [156104]
    Other proteins in same PDB: d3c92a1, d3c92b1, d3c92c1, d3c92d1, d3c92e1, d3c92f1, d3c92g1, d3c92o1, d3c92p1, d3c92q1, d3c92r1, d3c92s1, d3c92t1, d3c92u1
    automatically matched to d1pma1_

Details for d3c92k1

PDB Entry: 3c92 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with a closed gate
PDB Compounds: (K:) Proteasome subunit beta

SCOPe Domain Sequences for d3c92k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c92k1 d.153.1.4 (K:1-203) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3c92k1:

Click to download the PDB-style file with coordinates for d3c92k1.
(The format of our PDB-style files is described here.)

Timeline for d3c92k1: