Lineage for d3c91b1 (3c91 B:13-233)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2226378Species Thermoplasma acidophilum [TaxId:2303] [56256] (3 PDB entries)
  8. 2226394Domain d3c91b1: 3c91 B:13-233 [156067]
    Other proteins in same PDB: d3c9111, d3c9121, d3c91h1, d3c91i1, d3c91j1, d3c91k1, d3c91l1, d3c91m1, d3c91n1, d3c91v1, d3c91w1, d3c91x1, d3c91y1, d3c91z1
    automatically matched to d1pmaa_

Details for d3c91b1

PDB Entry: 3c91 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with an open gate
PDB Compounds: (B:) Proteasome subunit alpha

SCOPe Domain Sequences for d3c91b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c91b1 d.153.1.4 (B:13-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d3c91b1:

Click to download the PDB-style file with coordinates for d3c91b1.
(The format of our PDB-style files is described here.)

Timeline for d3c91b1: