Lineage for d2lhba_ (2lhb A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474608Protein Lamprey globin [46518] (2 species)
  7. 1474622Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [46519] (4 PDB entries)
  8. 1474623Domain d2lhba_: 2lhb A: [15597]
    complexed with cyn, hem

Details for d2lhba_

PDB Entry: 2lhb (more details), 2 Å

PDB Description: refinement of a molecular model for lamprey hemoglobin from petromyzon marinus
PDB Compounds: (A:) hemoglobin v (cyano met)

SCOPe Domain Sequences for d2lhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d2lhba_:

Click to download the PDB-style file with coordinates for d2lhba_.
(The format of our PDB-style files is described here.)

Timeline for d2lhba_: