| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries) |
| Domain d3c60g2: 3c60 G:1-82 [155966] Other proteins in same PDB: d3c60c1, d3c60d1, d3c60d2, d3c60g1, d3c60h1, d3c60h2 automatically matched to d1k2da2 |
PDB Entry: 3c60 (more details), 3.05 Å
SCOPe Domain Sequences for d3c60g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c60g2 d.19.1.1 (G:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp
Timeline for d3c60g2: