SCOP 1.75: Domain d3c60g2: 3c60 G:1-82

Lineage for d3c60g2 (3c60 G:1-82)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)

8. Domain d3c60g2: 3c60 G:1-82 [155966]
   Other proteins in same PDB: d3c60c1, d3c60d1, d3c60d2, d3c60g1, d3c60h1, d3c60h2
   automatically matched to d1k2da2

Details for d3c60g2

PDB Entry: 3c60, 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62

PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOP Domain Sequences for d3c60g2:

Sequence; same for both SEQRES and ATOM records:

>d3c60g2 d.19.1.1 (G:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

Timeline for d3c60g2:

• d3c60g2 is new in SCOP 1.75
  
• d3c60g2 appears in SCOPe 2.01
  
• d3c60g2 appears in the current release, SCOPe 2.08