Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Chimeric hemoglobin beta-alpha [46516] (1 species) |
Species Synthetic, based on Homo sapiens sequence [46517] (1 PDB entry) |
Domain d1ch4d_: 1ch4 D: [15596] complexed with cmo, hem |
PDB Entry: 1ch4 (more details), 2.5 Å
SCOPe Domain Sequences for d1ch4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ch4d_ a.1.1.2 (D:) Chimeric hemoglobin beta-alpha {Synthetic, based on Homo sapiens sequence} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa eftpavhasldkvlasvstvltskyr
Timeline for d1ch4d_: