SCOPe 2.03: Domain d1ch4d_: 1ch4 D:

Lineage for d1ch4d_ (1ch4 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Chimeric hemoglobin beta-alpha [46516] (1 species)

7. Species Synthetic, based on Homo sapiens sequence [46517] (1 PDB entry)

8. Domain d1ch4d_: 1ch4 D: [15596]
   complexed with cmo, hem

Details for d1ch4d_

PDB Entry: 1ch4, 2.5 Å

PDB Description: module-substituted chimera hemoglobin beta-alpha (f133v)

PDB Compounds: (D:) module-substituted chimera hemoglobin beta-alpha

SCOPe Domain Sequences for d1ch4d_:

Sequence; same for both SEQRES and ATOM records:

>d1ch4d_ a.1.1.2 (D:) Chimeric hemoglobin beta-alpha {Synthetic, based on Homo sapiens sequence}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
eftpavhasldkvlasvstvltskyr

Timeline for d1ch4d_:

• d1ch4d_ first appeared (with stable ids) in SCOP 1.55
  
• d1ch4d_ appears in SCOPe 2.02
  
• d1ch4d_ appears in SCOPe 2.04
  
• d1ch4d_ appears in the current release, SCOPe 2.08