Lineage for d1ch4d_ (1ch4 D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075005Protein Chimeric hemoglobin beta-alpha [46516] (1 species)
  7. 1075006Species Synthetic, based on Homo sapiens sequence [46517] (1 PDB entry)
  8. 1075010Domain d1ch4d_: 1ch4 D: [15596]
    complexed with cmo, hem

Details for d1ch4d_

PDB Entry: 1ch4 (more details), 2.5 Å

PDB Description: module-substituted chimera hemoglobin beta-alpha (f133v)
PDB Compounds: (D:) module-substituted chimera hemoglobin beta-alpha

SCOPe Domain Sequences for d1ch4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ch4d_ a.1.1.2 (D:) Chimeric hemoglobin beta-alpha {Synthetic, based on Homo sapiens sequence}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklrvdpvnfkllshcllvtlaahlpa
eftpavhasldkvlasvstvltskyr

SCOPe Domain Coordinates for d1ch4d_:

Click to download the PDB-style file with coordinates for d1ch4d_.
(The format of our PDB-style files is described here.)

Timeline for d1ch4d_: