| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (5 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
| Domain d3c1cb1: 3c1c B:25-102 [155859] Other proteins in same PDB: d3c1cc1, d3c1cd1, d3c1cg1, d3c1ch1 automatically matched to d1p3ob_ protein/DNA complex |
PDB Entry: 3c1c (more details), 3.15 Å
SCOPe Domain Sequences for d3c1cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1cb1 a.22.1.1 (B:25-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg
Timeline for d3c1cb1: