Lineage for d1c40b_ (1c40 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300396Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (4 PDB entries)
  8. 2300399Domain d1c40b_: 1c40 B: [15574]
    Other proteins in same PDB: d1c40a_
    complexed with hem

Details for d1c40b_

PDB Entry: 1c40 (more details), 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)
PDB Compounds: (B:) protein (hemoglobin (beta chain))

SCOPe Domain Sequences for d1c40b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c40b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1c40b_:

Click to download the PDB-style file with coordinates for d1c40b_.
(The format of our PDB-style files is described here.)

Timeline for d1c40b_: