SCOP 1.75: Domain d3bwgb2: 3bwg B:89-232

Lineage for d3bwgb2 (3bwg B:89-232)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (3 families)

5. Family d.190.1.2: UTRA domain [143473] (10 proteins)
   Pfam PF07702

6. Protein Transcriptional regulator YydK [160413] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160414] (1 PDB entry)
   Uniprot Q45591 89-233

8. Domain d3bwgb2: 3bwg B:89-232 [155696]
   Other proteins in same PDB: d3bwga1, d3bwgb1, d3bwgc1
   automatically matched to 3BWG A:89-233
   complexed with edo

Details for d3bwgb2

PDB Entry: 3bwg, 2.09 Å

PDB Description: The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (B:) Uncharacterized HTH-type transcriptional regulator yydK

SCOP Domain Sequences for d3bwgb2:

Sequence; same for both SEQRES and ATOM records:

>d3bwgb2 d.190.1.2 (B:89-232) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}
dfnvtskvieldvrkptpeaaenlnigmdediyyvkrvryingqtlcyeesyytksivty
lnneivshsifhyireglglkigfsdlflhvgqlneeeaeylgleaglpklyiesifhlt
ngqpfdyskisynyeqsqfvvqan

Timeline for d3bwgb2:

• d3bwgb2 is new in SCOP 1.75
  
• d3bwgb2 appears in SCOPe 2.01
  
• d3bwgb2 appears in the current release, SCOPe 2.08