Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins) |
Protein Transcriptional regulator YydK [158280] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158281] (1 PDB entry) Uniprot Q45591 5-82 |
Domain d3bwgc1: 3bwg C:5-79 [155697] Other proteins in same PDB: d3bwga2, d3bwgb2, d3bwgc2 automatically matched to 3BWG A:5-82 complexed with edo |
PDB Entry: 3bwg (more details), 2.09 Å
SCOP Domain Sequences for d3bwgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwgc1 a.4.5.6 (C:5-79) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} qqiateietyieehqlqqgdklpvletlmaqfevskstitkslelleqkgaifqvrgsgi fvrkhkrkgyislls
Timeline for d3bwgc1:
View in 3D Domains from other chains: (mouse over for more information) d3bwga1, d3bwga2, d3bwgb1, d3bwgb2 |