![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
![]() | Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
![]() | Protein Transcriptional regulator YydK [160413] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160414] (1 PDB entry) Uniprot Q45591 89-233 |
![]() | Domain d3bwgb2: 3bwg B:89-232 [155696] Other proteins in same PDB: d3bwga1, d3bwgb1, d3bwgc1 automated match to d3bwga2 complexed with edo |
PDB Entry: 3bwg (more details), 2.09 Å
SCOPe Domain Sequences for d3bwgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwgb2 d.190.1.2 (B:89-232) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} dfnvtskvieldvrkptpeaaenlnigmdediyyvkrvryingqtlcyeesyytksivty lnneivshsifhyireglglkigfsdlflhvgqlneeeaeylgleaglpklyiesifhlt ngqpfdyskisynyeqsqfvvqan
Timeline for d3bwgb2:
![]() Domains from other chains: (mouse over for more information) d3bwga1, d3bwga2, d3bwgc1, d3bwgc2 |