![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily) multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain |
![]() | Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) ![]() automatically mapped to Pfam PF08558 |
![]() | Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins) |
![]() | Protein TRF2 [63604] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries) |
![]() | Domain d3bu8b_: 3bu8 B: [155596] automated match to d1h6pa_ protein/DNA complex |
PDB Entry: 3bu8 (more details), 2.15 Å
SCOPe Domain Sequences for d3bu8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bu8b_ a.146.1.1 (B:) TRF2 {Human (Homo sapiens) [TaxId: 9606]} agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml rfleshlddaepylltmakkalksesa
Timeline for d3bu8b_: