Lineage for d3bu8b_ (3bu8 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734969Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2734970Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2734971Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)
  6. 2734979Protein TRF2 [63604] (1 species)
  7. 2734980Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)
  8. 2734982Domain d3bu8b_: 3bu8 B: [155596]
    automated match to d1h6pa_
    protein/DNA complex

Details for d3bu8b_

PDB Entry: 3bu8 (more details), 2.15 Å

PDB Description: Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
PDB Compounds: (B:) Telomeric repeat-binding factor 2

SCOPe Domain Sequences for d3bu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bu8b_ a.146.1.1 (B:) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr
vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav
iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml
rfleshlddaepylltmakkalksesa

SCOPe Domain Coordinates for d3bu8b_:

Click to download the PDB-style file with coordinates for d3bu8b_.
(The format of our PDB-style files is described here.)

Timeline for d3bu8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bu8a_